ABflo® 488 Rabbit anti-Cat CD19 mAb (A23100)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Cat CD19 mAb (Catalog Number: A23100) encodes a member of the immunoglobulin gene superfamily.
- Details & Specifications
- References
| Catalog No. | A23100 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Cat CD19 mAb (A23100) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Gene Name | CD19 |
| Protein Name | CD19 |
| Gene ID | 100125860 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Cat |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23100: ABflo® 488 Rabbit anti-Cat CD19 mAb
This gene encodes a member of the immunoglobulin gene superfamily. Expression of this cell surface protein is restricted to B cell lymphocytes. This protein is a reliable marker for pre-B cells but its expression diminishes during terminal B cell differentiation in antibody secreting plasma cells. The protein has two N-terminal extracellular Ig-like domains separated by a non-Ig-like domain, a hydrophobic transmembrane domain, and a large C-terminal cytoplasmic domain. This protein forms a complex with several membrane proteins including complement receptor type 2 (CD21) and tetraspanin (CD81) and this complex reduces the threshold for antigen-initiated B cell activation. Activation of this B-cell antigen receptor complex activates the phosphatidylinositol 3-kinase signalling pathway and the subsequent release of intracellular stores of calcium ions. This protein is a target of chimeric antigen receptor (CAR) T-cells used in the treatment of lymphoblastic leukemia. Mutations in this gene are associated with the disease common variable immunodeficiency 3 (CVID3) which results in a failure of B-cell differentiation and impaired secretion of immunoglobulins. CVID3 is characterized by hypogammaglobulinemia, an inability to mount an antibody response to antigen, and recurrent bacterial infections. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Immunogen Information about ABflo® 488 Rabbit anti-Cat CD19 mAb (A23100)
Immunogen:Recombinant protein of cat CD19.
Sequence:PQKTLLVEAKEGGKAELPCLKGPSDGPPEQQAWFQGAQSELDPGSQDLGIQKGPLGLQLLIFNVSDQMGGFYVCQLGPPSEQAWQSGWTVSVEGSGELFRWNASYLNDPGCGLGNRSSEGYPTSSQLYVWAKGHPEIWETDPDCASPRGGLDQSLNQDVTVAPGSTFWLPCEVPPASVARGPISWTLVRPKKHNISLLHLNLREDAPVREMWVLDTLRGGAVLLLPQATAQDAGTYHCYHGNMTIEMQLKVTAQSVRHWLLEAGGWKVPVVPL
Gene ID:100125860
Swiss prot:
Synonyms:
Calculated MW:61kDa
Observed MW:
Images of ABflo® 488 Rabbit anti-Cat CD19 mAb (A23100)

Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Cat CD19 mAb(A23100, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Cat CD19 mAb(A23100, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Cat CD19 mAb (Catalog Number: A23100) Abclonal


