TROP-2 Rabbit mAb (A20824)

TROP-2 Rabbit mAb (A20824)

TROP-2 Rabbit mAb (A20824)

$148.00$548.00

In stock

$148.00$548.00

Abclonal TROP-2 Rabbit mAb (Catalog Number: A20824) encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.

Store
SKU: A20824 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A20824
Product NameTROP-2 Rabbit mAb (A20824)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Gene Name TACSTD2
Protein Name TACSTD2
Uniprot/Swissprot ID P09758
Gene ID 4070
Clone ARC51513
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A20824: TROP-2 Rabbit mAb

This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.

Immunogen Information about TROP-2 Rabbit mAb (A20824)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Gene ID:4070
Swiss prot:P09758
Synonyms:EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1; TROP-2
Calculated MW:36kDa
Observed MW:40-65kDa

Images of TROP-2 Rabbit mAb (A20824)

Western blot analysis of extracts from various cell lines, using TROP-2 antibody (A20824) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of extracts from various cell lines, using TROP-2 antibody (A20824) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human breast cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human esophageal cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human kidney tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human pancreas tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human placenta tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human prostate cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human thyroid cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human tonsil tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Confocal imaging of MCF7 cells using TROP-2 Rabbit mAb (A20824, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Please remember our product information: TROP-2 Rabbit mAb (Catalog Number: A20824) Abclonal