TROP-2 Rabbit mAb (A20824)
$148.00 – $548.00
Abclonal TROP-2 Rabbit mAb (Catalog Number: A20824) encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.
- Details & Specifications
- References
| Catalog No. | A20824 |
|---|---|
| Product Name | TROP-2 Rabbit mAb (A20824) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1 |
| Gene Name | TACSTD2 |
| Protein Name | TACSTD2 |
| Uniprot/Swissprot ID | P09758 |
| Gene ID | 4070 |
| Clone | ARC51513 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A20824: TROP-2 Rabbit mAb
This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.
Immunogen Information about TROP-2 Rabbit mAb (A20824)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human TROP-2 (NP_002344.2).
Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Gene ID:4070
Swiss prot:P09758
Synonyms:EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1; TROP-2
Calculated MW:36kDa
Observed MW:40-65kDa
Images of TROP-2 Rabbit mAb (A20824)

Western blot analysis of extracts from various cell lines, using TROP-2 antibody (A20824) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of extracts from various cell lines, using TROP-2 antibody (A20824) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human breast cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human esophageal cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human kidney tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human pancreas tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human placenta tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human prostate cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human thyroid cancer tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of TROP-2 in paraffin-embedded human tonsil tissue using TROP-2 Rabbit mAb (A20824) at a dilution of 1:8000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Confocal imaging of MCF7 cells using TROP-2 Rabbit mAb (A20824, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Please remember our product information: TROP-2 Rabbit mAb (Catalog Number: A20824) Abclonal







