Thyroglobulin Rabbit mAb (A3407)
$148.00 – $548.00
Abclonal Thyroglobulin Rabbit mAb (Catalog Number: A3407) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine.
- Details & Specifications
- References
| Catalog No. | A3407 |
|---|---|
| Product Name | Thyroglobulin Rabbit mAb (A3407) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | TGN; AITD3 |
| Gene Name | TG |
| Protein Name | TG |
| Uniprot/Swissprot ID | P01266 |
| Gene ID | 7038 |
| Clone | ARC1971 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A3407: Thyroglobulin Rabbit mAb
Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis.
Immunogen Information about Thyroglobulin Rabbit mAb (A3407)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Thyroglobulin (P01266).
Sequence:STLSFYQRRRFSPDDSAGASALLRSGPYMPQCDAFGSWEPVQCHAGTGHCWCVDEKGGFIPGSLTARSLQIPQCPTTCEKSRTSGLLSSWKQARSQENPSP
Gene ID:7038
Swiss prot:P01266
Synonyms:TGN; AITD3; Thyroglobulin
Calculated MW:305kDa
Observed MW:
Images of Thyroglobulin Rabbit mAb (A3407)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using Thyroglobulin Rabbit mAb (A3407) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of rat thyroid using Thyroglobulin Rabbit mAb (A3407) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of human thyroid using Thyroglobulin Rabbit mAb (A3407) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse thyroid using Thyroglobulin Rabbit mAb (A3407) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Please remember our product information: Thyroglobulin Rabbit mAb (Catalog Number: A3407) Abclonal







