S100B Rabbit mAb (A23493)
$148.00 – $548.00
Abclonal S100B Rabbit mAb (Catalog Number: A23493) encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs.
- Details & Specifications
- References
- More Offers
| Catalog No. | A23493 |
|---|---|
| Product Name | S100B Rabbit mAb (A23493) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | NEF; S100; S100-B; S100beta |
| Gene Name | S100B |
| Protein Name | S100B |
| Uniprot/Swissprot ID | P04271 |
| Gene ID | 6285 |
| Clone | ARC0479 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23493: S100B Rabbit mAb
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer’s disease, Down’s syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes.
Immunogen Information about S100B Rabbit mAb (A23493)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100B (NP_006263.1).
Sequence：MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Gene ID：6285
Swiss prot：P04271
Synonyms：NEF; S100; S100-B; S100beta; S100B
Calculated MW：11kDa
Observed MW：11kDa
Images of S100B Rabbit mAb (A23493)
Western blot analysis of various lysates using S100B Rabbit mAb (A23493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates using S100B Rabbit mAb (A23493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of S100B in paraffin-embedded human appendix using S100B Rabbit mAb (A23493) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of S100B in paraffin-embedded human colon carcinoma using S100B Rabbit mAb (A23493) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of S100B in paraffin-embedded mouse brain using S100B Rabbit mAb (A23493) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of S100B in paraffin-embedded rat lymph node using S100B Rabbit mAb (A23493) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of paraffin-embedded rat brain using S100B Rabbit mAb (A23493) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded mouse brain using S100B Rabbit mAb (A23493) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Please remember our product information: S100B Rabbit mAb (Catalog Number: A23493) Abclonal
