Placental alkaline phosphatase (PLAP) Rabbit mAb (A4304)
$148.00 – $548.00
Abclonal Placental alkaline phosphatase (PLAP) Rabbit mAb (Catalog Number: A4304) encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes.
- Details & Specifications
- References
- More Offers
| Catalog No. | A4304 |
|---|---|
| Product Name | Placental alkaline phosphatase (PLAP) Rabbit mAb (A4304) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | ALP; IAP; ALPI; PALP; PLAP; PLAP-1 |
| Gene Name | ALPP |
| Protein Name | ALPP |
| Uniprot/Swissprot ID | P05187 |
| Gene ID | 250 |
| Clone | ARC0961 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A4304: Placental alkaline phosphatase (PLAP) Rabbit mAb
The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it’s one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells.
Immunogen Information about Placental alkaline phosphatase (PLAP) Rabbit mAb (A4304)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Placental alkaline phosphatase (PLAP) (P05187).
Sequence：ALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASA
Gene ID：250
Swiss prot：P05187
Synonyms：ALP; IAP; ALPI; PALP; PLAP; PLAP-1; Placental alkaline phosphatase (PLAP)
Calculated MW：58kDa
Observed MW：70kDa
Images of Placental alkaline phosphatase (PLAP) Rabbit mAb (A4304)
Western blot analysis of extracts of PC-3 cells, using Placental alkaline phosphatase (PLAP) Rabbit mAb (A4304) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Mouse testis, using Placental alkaline phosphatase (PLAP) Rabbit mAb (A4304) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded Human placenta using Placental alkaline phosphatase (PLAP) antibody (A4304) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: Placental alkaline phosphatase (PLAP) Rabbit mAb (Catalog Number: A4304) Abclonal
