LIN28A Rabbit mAb (A21261)
$148.00 – $548.00
Abclonal LIN28A Rabbit mAb (Catalog Number: A21261) encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells.
- Details & Specifications
- References
| Catalog No. | A21261 |
|---|---|
| Product Name | LIN28A Rabbit mAb (A21261) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A |
| Gene Name | LIN28A |
| Protein Name | LIN28A |
| Uniprot/Swissprot ID | Q9H9Z2 |
| Gene ID | 79727 |
| Clone | ARC53062 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A21261: LIN28A Rabbit mAb
This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.
Immunogen Information about LIN28A Rabbit mAb (A21261)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-209 of human LIN28A (NP_078950.1).
Sequence:SAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Gene ID:79727
Swiss prot:Q9H9Z2
Synonyms:CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A; LIN28A
Calculated MW:23kDa
Observed MW:28kDa
Images of LIN28A Rabbit mAb (A21261)

Western blot analysis of extracts of various cell lines, using LIN28A antibody (A21261) at 1:60000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Immunohistochemistry analysis of paraffin-embedded Human embryonic carcinoma using LIN28A Rabbit mAb (A21261) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using LIN28A Rabbit mAb (A21261) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human seminoma using LIN28A Rabbit mAb (A21261) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Confocal imaging of HeLa cells using LIN28A Rabbit mAb (A21261, dilution 1:200)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
Please remember our product information: LIN28A Rabbit mAb (Catalog Number: A21261) Abclonal







