LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

$148.00$548.00

In stock

$148.00$548.00

Abclonal LI Cadherin/Cadherin-17 Rabbit mAb (Catalog Number: A5286) is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain.

Store
SKU: A5286 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A5286
Product NameLI Cadherin/Cadherin-17 Rabbit mAb (A5286)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms HPT1; CDH16; HPT-1
Gene Name CDH17
Protein Name CDH17
Uniprot/Swissprot ID Q12864
Gene ID 1015
Clone ARC1989
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A5286: LI Cadherin/Cadherin-17 Rabbit mAb

This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants.

Immunogen Information about LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LI Cadherin/Cadherin-17 (Q12864).
Sequence:MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALD
Gene ID:1015
Swiss prot:Q12864
Synonyms:HPT1; CDH16; HPT-1; LI Cadherin/Cadherin-17
Calculated MW:92kDa
Observed MW:120kDa

Images of LI Cadherin/Cadherin-17 Rabbit mAb (A5286)

Western blot analysis of extracts of various cell lines, using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded human gastric cancer using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human pancreatic ductal carcinoma using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human stomach using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Confocal imaging of Human colon cancer using LI Cadherin/Cadherin-17 Rabbit mAb (A5286, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Immunofluorescence analysis of mouse Intestine using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of rat rectum using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Please remember our product information: LI Cadherin/Cadherin-17 Rabbit mAb (Catalog Number: A5286) Abclonal