LI Cadherin/Cadherin-17 Rabbit mAb (A5286)
$148.00 – $548.00
Abclonal LI Cadherin/Cadherin-17 Rabbit mAb (Catalog Number: A5286) is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain.
- Details & Specifications
- References
- More Offers
| Catalog No. | A5286 |
|---|---|
| Product Name | LI Cadherin/Cadherin-17 Rabbit mAb (A5286) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | HPT1; CDH16; HPT-1 |
| Gene Name | CDH17 |
| Protein Name | CDH17 |
| Uniprot/Swissprot ID | Q12864 |
| Gene ID | 1015 |
| Clone | ARC1989 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A5286: LI Cadherin/Cadherin-17 Rabbit mAb
This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants.
Immunogen Information about LI Cadherin/Cadherin-17 Rabbit mAb (A5286)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LI Cadherin/Cadherin-17 (Q12864).
Sequence：MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALD
Gene ID：1015
Swiss prot：Q12864
Synonyms：HPT1; CDH16; HPT-1; LI Cadherin/Cadherin-17
Calculated MW：92kDa
Observed MW：120kDa
Images of LI Cadherin/Cadherin-17 Rabbit mAb (A5286)
Western blot analysis of extracts of various cell lines, using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human gastric cancer using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human pancreatic ductal carcinoma using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human stomach using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Confocal imaging of Human colon cancer using LI Cadherin/Cadherin-17 Rabbit mAb (A5286, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.
Immunofluorescence analysis of mouse Intestine using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat rectum using LI Cadherin/Cadherin-17 Rabbit mAb (A5286) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Please remember our product information: LI Cadherin/Cadherin-17 Rabbit mAb (Catalog Number: A5286) Abclonal
