Ki67 Rabbit mAb (A20018)
$148.00 – $548.00
Abclonal Ki67 Rabbit mAb (Catalog Number: A20018) Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division.
- Details & Specifications
- References
| Catalog No. | A20018 |
|---|---|
| Product Name | Ki67 Rabbit mAb (A20018) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | KIA; MIB-; MIB-1; PPP1R105 |
| Gene Name | MKI67 |
| Protein Name | MKI67 |
| Uniprot/Swissprot ID | P46013 |
| Gene ID | 4288 |
| Clone | ARC5050-01 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A20018: Ki67 Rabbit mAb
Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn’s disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett’s esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.
Immunogen Information about Ki67 Rabbit mAb (A20018)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Ki67 (NP_002408.3).
Sequence:LAGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK
Gene ID:4288
Swiss prot:P46013
Synonyms:KIA; MIB-; MIB-1; PPP1R105; Ki67
Calculated MW:359kDa
Observed MW:Refer to figures
Images of Ki67 Rabbit mAb (A20018)

Immunohistochemistry analysis of Ki67 in paraffin-embedded human cervix cancer using Ki67 Rabbit mAb (A20018) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of Ki67 in paraffin-embedded human colon carcinoma using Ki67 Rabbit mAb (A20018) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Confocal imaging of HeLa cells using Ki67 Rabbit mAb (A20018, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
Please remember our product information: Ki67 Rabbit mAb (Catalog Number: A20018) Abclonal





