IGHD Rabbit mAb (A19708)
$148.00 – $548.00
Abclonal IGHD Rabbit mAb (Catalog Number: A19708) Predicted to enable antigen binding activity and immunoglobulin receptor binding activity.
- Details & Specifications
- References
| Catalog No. | A19708 |
|---|---|
| Product Name | IGHD Rabbit mAb (A19708) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Gene Name | IGHD |
| Protein Name | IGHD |
| Uniprot/Swissprot ID | P01880 |
| Gene ID | 3495 |
| Clone | ARC2240 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19708: IGHD Rabbit mAb
Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in positive regulation of interleukin-1 production. Located in blood microparticle and extracellular exosome.
Immunogen Information about IGHD Rabbit mAb (A19708)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IGHD (P01880).
Sequence：APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHPTSVTVTWYMGTQSQPQRTFPEIQRRDSYYMTSSQLSTPLQQWRQGEYKCVVQHTASKSKKEIFRW
Gene ID：3495
Swiss prot：P01880
Synonyms：
Calculated MW：42kDa
Observed MW：55kDa
Images of IGHD Rabbit mAb (A19708)
Western blot analysis of extracts of Human plasma, using IGHD Rabbit mAb (A19708) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using IGHD antibody (A19708) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human Hodgkin lymphoma using IGHD antibody (A19708) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: IGHD Rabbit mAb (Catalog Number: A19708) Abclonal
