IGHD Rabbit mAb (A19708)

IGHD Rabbit mAb (A19708)

IGHD Rabbit mAb (A19708)

$148.00$548.00

In stock

$148.00$548.00

Abclonal IGHD Rabbit mAb (Catalog Number: A19708) Predicted to enable antigen binding activity and immunoglobulin receptor binding activity.

Store
SKU: A19708 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A19708
Product NameIGHD Rabbit mAb (A19708)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Gene Name IGHD
Protein Name IGHD
Uniprot/Swissprot ID P01880
Gene ID 3495
Clone ARC2240
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A19708: IGHD Rabbit mAb

Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in positive regulation of interleukin-1 production. Located in blood microparticle and extracellular exosome.

Immunogen Information about IGHD Rabbit mAb (A19708)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IGHD (P01880).
Sequence:APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHPTSVTVTWYMGTQSQPQRTFPEIQRRDSYYMTSSQLSTPLQQWRQGEYKCVVQHTASKSKKEIFRW
Gene ID:3495
Swiss prot:P01880
Synonyms:
Calculated MW:42kDa
Observed MW:55kDa

Images of IGHD Rabbit mAb (A19708)

Western blot analysis of extracts of Human plasma, using IGHD Rabbit mAb (A19708) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using IGHD antibody (A19708) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human Hodgkin lymphoma using IGHD antibody (A19708) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Please remember our product information: IGHD Rabbit mAb (Catalog Number: A19708) Abclonal