IGF1 Rabbit mAb (A0830)
$148.00 – $548.00
Abclonal IGF1 Rabbit mAb (Catalog Number: A0830) encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A0830 |
|---|---|
| Product Name | IGF1 Rabbit mAb (A0830) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | IGF; MGF; IGFI; IGF-I |
| Gene Name | IGF1 |
| Protein Name | IGF1 |
| Uniprot/Swissprot ID | P05019 |
| Entrez GeneID | 3479 |
| Clone | ARC0505 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | IHC-P |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A0830: IGF1 Rabbit mAb
The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.
Immunogen Information about IGF1 Rabbit mAb (A0830)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 70-150 of human IGF1 (P05019).
Sequence：GFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRK
Gene ID：3479
Swiss prot：P05019
Synonyms：IGF; MGF; IGFI; IGF-I; IGF1
Calculated MW：22kDa
Observed MW：Refer to figures
Images of IGF1 Rabbit mAb (A0830)
Immunohistochemistry analysis of IGF1 in paraffin-embedded human colon using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of IGF1 in paraffin-embedded human liver using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of IGF1 in paraffin-embedded Human lung adenocarcinoma using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of IGF1 in paraffin-embedded human placenta using IGF1 Rabbit mAb (A0830) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Please remember our product information: IGF1 Rabbit mAb (Catalog Number: A0830) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 20 ul, 100 ul, 200 ul, 50 ul |