GST3/GSTP1 Rabbit mAb (A19061)
$148.00 – $548.00
Abclonal GST3/GSTP1 Rabbit mAb (Catalog Number: A19061) Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione.
- Details & Specifications
- References
| Catalog No. | A19061 |
|---|---|
| Product Name | GST3/GSTP1 Rabbit mAb (A19061) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22 |
| Gene Name | GSTP1 |
| Protein Name | GSTP1 |
| Uniprot/Swissprot ID | P09211 |
| Gene ID | 2950 |
| Clone | ARC0439 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19061: GST3/GSTP1 Rabbit mAb
Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.
Immunogen Information about GST3/GSTP1 Rabbit mAb (A19061)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100-201 of human GST3/GSTP1 (P09211).
Sequence:LRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVN
Gene ID:2950
Swiss prot:P09211
Synonyms:PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22; GST3/GSTP1
Calculated MW:23kDa
Observed MW:25kDa
Images of GST3/GSTP1 Rabbit mAb (A19061)

Western blot analysis of extracts of various cell lines, using GST3/GSTP1 antibody (A19061) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Immunohistochemistry analysis of paraffin-embedded human breast cancer using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human lung squamous carcinoma tissue using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse brain using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat liver using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat testis using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: GST3/GSTP1 Rabbit mAb (Catalog Number: A19061) Abclonal






