Glucagon Rabbit mAb (A23029)
$148.00 – $548.00
Abclonal Glucagon Rabbit mAb (Catalog Number: A23029) encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides.
- Details & Specifications
- References
- More Offers
| Catalog No. | A23029 |
|---|---|
| Product Name | Glucagon Rabbit mAb (A23029) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | GLP1; GLP2; GRPP; GLP-1 |
| Gene Name | GCG |
| Protein Name | GCG |
| Uniprot/Swissprot ID | P01275 |
| Gene ID | 2641 |
| Clone | ARC56936 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23029: Glucagon Rabbit mAb
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Immunogen Information about Glucagon Rabbit mAb (A23029)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glucagon (NP_002045.1).
Sequence:MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAE
Gene ID:2641
Swiss prot:P01275
Synonyms:GLP1; GLP2; GRPP; GLP-1; Glucagon
Calculated MW:21kDa
Observed MW:Refer to figures
Images of Glucagon Rabbit mAb (A23029)

Immunohistochemistry analysis of paraffin-embedded human pancreas using Glucagon Rabbit mAb (A23029) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of mouse pancreas using Glucagon Rabbit mAb (A23029) at dilution of 1:500 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of rat pancreas using Glucagon Rabbit mAb (A23029) at dilution of 1:500 (40x lens). Blue: DAPI for nuclear staining.
Please remember our product information: Glucagon Rabbit mAb (Catalog Number: A23029) Abclonal





