EpCAM Rabbit mAb (A1107)

EpCAM Rabbit mAb (A1107)

EpCAM Rabbit mAb (A1107)

$148.00$548.00

In stock

$148.00$548.00

Abclonal EpCAM Rabbit mAb (Catalog Number: A1107) encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins.

Store
SKU: A1107 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A1107
Product NameEpCAM Rabbit mAb (A1107)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1
Gene Name EPCAM
Protein Name EPCAM
Uniprot/Swissprot ID P16422
Gene ID 4072
Clone ARC0521
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A1107: EpCAM Rabbit mAb

This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Immunogen Information about EpCAM Rabbit mAb (A1107)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EpCAM (P16422).
Sequence:MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCD
Gene ID:4072
Swiss prot:P16422
Synonyms:ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1; EpCAM
Calculated MW:35kDa
Observed MW:40kDa

Images of EpCAM Rabbit mAb (A1107)

Western blot analysis of extracts of various cell lines, using EpCAM Rabbit mAb (A1107) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human kidney using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver cancer using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Please remember our product information: EpCAM Rabbit mAb (Catalog Number: A1107) Abclonal