EGFR (L858R) Rabbit mAb (A5031)
$148.00 – $548.00
Abclonal EGFR (L858R) Rabbit mAb (Catalog Number: A5031) encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family.
- Details & Specifications
- References
- More Offers
| Catalog No. | A5031 |
|---|---|
| Product Name | EGFR (L858R) Rabbit mAb (A5031) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2 |
| Gene Name | EGFR |
| Protein Name | EGFR |
| Uniprot/Swissprot ID | P00533 |
| Gene ID | 1956 |
| Clone | ARC1139 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A5031: EGFR (L858R) Rabbit mAb
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).
Immunogen Information about EGFR (L858R) Rabbit mAb (A5031)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 800-900 of human EGFR (L858R) (P00533).
Sequence:DYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
Gene ID:1956
Swiss prot:P00533
Synonyms:ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2; EGFR (L858R)
Calculated MW:134kDa
Observed MW:175kDa
Images of EGFR (L858R) Rabbit mAb (A5031)

Western blot analysis of extracts of Mouse brain cells, using EGFR (L858R) Rabbit mAb (A5031) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma (egfr-e745-a750del positive sample) using EGFR (L858R) Rabbit mAb (A5031) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma (egfr-l858r positive sample) using EGFR (L858R) Rabbit mAb (A5031) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma (egfr-l858r positive sample) using EGFR (L858R) Rabbit mAb (A5031) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma (egfr-l858r positive sample) using EGFR (L858R) Rabbit mAb (A5031) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: EGFR (L858R) Rabbit mAb (Catalog Number: A5031) Abclonal







