Cytokeratin 7 (KRT7) Rabbit mAb (A4765)
$148.00 – $548.00
Abclonal Cytokeratin 7 (KRT7) Rabbit mAb (Catalog Number: A4765) encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A4765 |
|---|---|
| Product Name | Cytokeratin 7 (KRT7) Rabbit mAb (A4765) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | K7; CK7; SCL; K2C7 |
| Gene Name | KRT7 |
| Protein Name | KRT7 |
| Uniprot/Swissprot ID | P08729 |
| Entrez GeneID | 3855 |
| Clone | ARC1267 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | WB, IHC-P, IF/ICC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A4765: Cytokeratin 7 (KRT7) Rabbit mAb
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described.
Immunogen Information about Cytokeratin 7 (KRT7) Rabbit mAb (A4765)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 7 (KRT7) (P08729).
Sequence：MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN
Gene ID：3855
Swiss prot：P08729
Synonyms：K7; CK7; SCL; K2C7; Cytokeratin 7 (KRT7)
Calculated MW：51kDa
Observed MW：52kDa
Images of Cytokeratin 7 (KRT7) Rabbit mAb (A4765)
Western blot analysis of various lysates using Cytokeratin 7 (KRT7) (KRT7) Rabbit mAb (A4765) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates using Cytokeratin 7 (KRT7) (KRT7) Rabbit mAb (A4765) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of Cytokeratin 7 (KRT7) in paraffin-embedded human breast using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of Cytokeratin 7 (KRT7) in paraffin-embedded human lung using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of Cytokeratin 7 (KRT7) in paraffin-embedded human pancreas using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of Cytokeratin 7 (KRT7) in paraffin-embedded human breast cancer using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of paraffin-embedded human lung using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Please remember our product information: Cytokeratin 7 (KRT7) Rabbit mAb (Catalog Number: A4765) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 20 ul, 100 ul, 200 ul, 50 ul |