Cytokeratin 20 (CK20) Rabbit mAb (A19041)

Cytokeratin 20 (CK20) Rabbit mAb (A19041)

Cytokeratin 20 (CK20) Rabbit mAb (A19041)

$148.00$548.00

In stock

$148.00$548.00

Abclonal Cytokeratin 20 (CK20) Rabbit mAb (Catalog Number: A19041) encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.

Store
SKU: A19041 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A19041
Product NameCytokeratin 20 (CK20) Rabbit mAb (A19041)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms K20; CD20; CK20; CK-20; KRT21
Gene Name KRT20
Protein Name KRT20
Uniprot/Swissprot ID P35900
Gene ID 54474
Clone ARC0288
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A19041: Cytokeratin 20 (CK20) Rabbit mAb

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.

Immunogen Information about Cytokeratin 20 (CK20) Rabbit mAb (A19041)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 325-424 of human Cytokeratin 20 (KRT20) (P35900).
Sequence:LANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI
Gene ID:54474
Swiss prot:P35900
Synonyms:K20; CD20; KRT20; CK-20; KRT21; Cytokeratin 20 (CK20)
Calculated MW:48kDa
Observed MW:44kDa

Images of Cytokeratin 20 (CK20) Rabbit mAb (A19041)

Western blot analysis of extracts of HT-29 cells, using Cytokeratin 20 (KRT20) (KRT20) antibody (A19041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts of Rat liver, using Cytokeratin 20 (KRT20) (KRT20) antibody (A19041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Immunohistochemistry analysis of paraffin-embedded human stomach using Cytokeratin 20 (CK20) Rabbit mAb (A19041) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Please remember our product information: Cytokeratin 20 (CK20) Rabbit mAb (Catalog Number: A19041) Abclonal

No more offers for this product!