Cyclin E1 Rabbit mAb (A22360)
$148.00 – $548.00
Abclonal Cyclin E1 Rabbit mAb (Catalog Number: A22360) encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle.
- Details & Specifications
- References
| Catalog No. | A22360 |
|---|---|
| Product Name | Cyclin E1 Rabbit mAb (A22360) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CCNE; pCCNE1 |
| Gene Name | CCNE1 |
| Protein Name | CCNE1 |
| Uniprot/Swissprot ID | P24864 |
| Gene ID | 898 |
| Clone | ARC51383 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22360: Cyclin E1 Rabbit mAb
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2, whose activity is required for cell cycle G1/S transition. This protein accumulates at the G1-S phase boundary and is degraded as cells progress through S phase. Overexpression of this gene has been observed in many tumors, which results in chromosome instability, and thus may contribute to tumorigenesis. This protein was found to associate with, and be involved in, the phosphorylation of NPAT protein (nuclear protein mapped to the ATM locus), which participates in cell-cycle regulated histone gene expression and plays a critical role in promoting cell-cycle progression in the absence of pRB.
Immunogen Information about Cyclin E1 Rabbit mAb (A22360)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Cyclin E1 (NP_001229.1).
Sequence:AASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSG
Gene ID:898
Swiss prot:P24864
Synonyms:CCNE; pCCNE1; Cyclin E1
Calculated MW:47kDa
Observed MW:48kDa
Images of Cyclin E1 Rabbit mAb (A22360)

Western blot analysis of Mouse spleen, using CyclinE1 antibody (A22360) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Cyclin E1 Rabbit mAb (A22360) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver cancer using Cyclin E1 Rabbit mAb (A22360) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using Cyclin E1 Rabbit mAb (A22360) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse brain using Cyclin E1 Rabbit mAb (A22360) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: Cyclin E1 Rabbit mAb (Catalog Number: A22360) Abclonal






