Chromogranin A Rabbit mAb (A9576)
$148.00 – $548.00
Abclonal Chromogranin A Rabbit mAb (Catalog Number: A9576) encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells.
- Details & Specifications
- References
- More Offers
| Catalog No. | A9576 |
|---|---|
| Product Name | Chromogranin A Rabbit mAb (A9576) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CGA; PHE5; PHES |
| Gene Name | CHGA |
| Protein Name | CHGA |
| Uniprot/Swissprot ID | P10645 |
| Gene ID | 1113 |
| Clone | ARC1643 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A9576: Chromogranin A Rabbit mAb
The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Two other peptides, catestatin and chromofungin, have antimicrobial activity and antifungal activity, respectively. Two transcript variants encoding different isoforms have been found for this gene.
Immunogen Information about Chromogranin A Rabbit mAb (A9576)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Chromogranin A (P10645).
Sequence：MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF
Gene ID：1113
Swiss prot：P10645
Synonyms：CGA; PHE5; PHES; Chromogranin A
Calculated MW：51kDa
Observed MW： 80kDa
Images of Chromogranin A Rabbit mAb (A9576)
Western blot analysis of extracts of various cell lines, using Chromogranin A antibody (A9576) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded rat pancreatic islet using Chromogranin A Rabbit mAb (A9576) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using Chromogranin A Rabbit mAb (A9576) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse pancreatic islet using Chromogranin A Rabbit mAb (A9576) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Confocal imaging of Human pancreas using Chromogranin A Rabbit mAb (A9576, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.
Please remember our product information: Chromogranin A Rabbit mAb (Catalog Number: A9576) Abclonal
