CD8A Rabbit mAb (A0663)
$148.00 – $548.00
Abclonal CD8A Rabbit mAb (Catalog Number: A0663) is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system.
- Details & Specifications
- References
| Catalog No. | A0663 |
|---|---|
| Product Name | CD8A Rabbit mAb (A0663) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | CD8; p32; Leu2; CD8alpha |
| Gene Name | CD8A |
| Protein Name | CD8A |
| Uniprot/Swissprot ID | P01732 |
| Gene ID | 925 |
| Clone | ARC0329 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A0663: CD8A Rabbit mAb
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.
Immunogen Information about CD8A Rabbit mAb (A0663)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 136-235 of human CD8A (P01732).
Sequence:KPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Gene ID:925
Swiss prot:P01732
Synonyms:CD8; p32; Leu2; CD8alpha; CD8A
Calculated MW:26kDa
Observed MW:35kDa
Images of CD8A Rabbit mAb (A0663)

Western blot analysis of various lysates using CD8A Rabbit mAb (A0663) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Flow cytometry: U937 cells were stained with Rabbit IgG isotype control (AC042, 10 μg/mL, blue line) or CD8A Rabbit mAb (A0663, 10 μg/mL orange line), followed by FITC conjugated goat anti-Rabbit pAb (AS083, 1:200 dilution) staining. Non-fluorescently stained U937 cells were used as blank control (red line).

Flow cytometry: Jurkat cells were stained with Rabbit IgG isotype control (AC042, 10 μg/mL, blue line) or CD8A Rabbit mAb (A0663, 10 μg/mL orange line), followed by FITC conjugated goat anti-Rabbit pAb (AS083, 1:200 dilution) staining. Non-fluorescently stained Jurkat cells were used as blank control (red line).

Flow cytometry: TALL-104 cells were stained with Rabbit IgG isotype control (AC042, 10 μg/mL, blue line) or CD8A Rabbit mAb (A0663, 10 μg/mL orange line), followed by FITC conjugated goat anti-Rabbit pAb (AS083, 1:200 dilution) staining. Non-fluorescently stained TALL-104 cells were used as blank control (red line).
Please remember our product information: CD8A Rabbit mAb (Catalog Number: A0663) Abclonal






