CD79B Rabbit mAb (A21224)

CD79B Rabbit mAb (A21224)

CD79B Rabbit mAb (A21224)

$148.00$548.00

In stock

$148.00$548.00

Abclonal CD79B Rabbit mAb (Catalog Number: A21224) The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig).

Store
SKU: A21224 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A21224
Product NameCD79B Rabbit mAb (A21224)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms B29; IGB; AGM6; Igbeta
Gene Name CD79B
Protein Name CD79B
Uniprot/Swissprot ID P40259
Gene ID 974
Clone ARC52683
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A21224: CD79B Rabbit mAb

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen Information about CD79B Rabbit mAb (A21224)

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 130-229 of human CD79B (NP_000617.1).
Sequence:SEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Gene ID:974
Swiss prot:P40259
Synonyms:B29; IGB; AGM6; Igbeta; CD79B
Calculated MW:26kDa
Observed MW:30-50kDa

Images of CD79B Rabbit mAb (A21224)

Western blot analysis of various lysates, using CD79B antibody (A21224) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen using CD79B antibody (A21224) at dilution of 1:400(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using CD79B antibody (A21224) at dilution of 1:400(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using CD79B antibody (A21224) at dilution of 1:400(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human B-cell lymphoma using CD79B Rabbit mAb (A21224) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human mantle cell lymphoma using CD79B Rabbit mAb (A21224) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Please remember our product information: CD79B Rabbit mAb (Catalog Number: A21224) Abclonal