CD63 Rabbit mAb (A19023)
$148.00 – $548.00
Abclonal CD63 Rabbit mAb (Catalog Number: A19023) encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family.
- Details & Specifications
- References
| Catalog No. | A19023 |
|---|---|
| Product Name | CD63 Rabbit mAb (A19023) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | MLA1; ME491; LAMP-3; OMA81H; TSPAN30 |
| Gene Name | CD63 |
| Protein Name | CD63 |
| Uniprot/Swissprot ID | P08962 |
| Gene ID | 967 |
| Clone | ARC51703 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19023: CD63 Rabbit mAb
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.
Immunogen Information about CD63 Rabbit mAb (A19023)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 103-203 of human CD63 (NP_001771.1).
Sequence:AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Gene ID:967
Swiss prot:P08962
Synonyms:MLA1; ME491; LAMP-3; OMA81H; TSPAN30; CD63
Calculated MW:17kDa/23kDa/25kDa
Observed MW:30-65kDa
Images of CD63 Rabbit mAb (A19023)

Western blot analysis of lysates from A375 cells, using CD63 Rabbit mAb (A19023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of various lysates, using CD63 Rabbit mAb (A19023) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Immunohistochemistry analysis of CD63 in paraffin-embedded human colon using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of CD63 in paraffin-embedded human tonsil using CD63 Rabbit mAb (A19023) at dilution of 1:10000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: CD63 Rabbit mAb (Catalog Number: A19023) Abclonal







