CD45 Rabbit mAb (A23503)
$148.00 – $548.00
Abclonal CD45 Rabbit mAb (Catalog Number: A23503) encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation.
- Details & Specifications
- References
- More Offers
| Catalog No. | A23503 |
|---|---|
| Product Name | CD45 Rabbit mAb (A23503) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180; IMD105 |
| Gene Name | PTPRC |
| Protein Name | PTPRC |
| Uniprot/Swissprot ID | P08575 |
| Gene ID | 5788 |
| Clone | ARC52280 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23503: CD45 Rabbit mAb
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. This PTP also suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported.
Immunogen Information about CD45 Rabbit mAb (A23503)
Immunogen：Recombinant Protein corresponding to a sequence within amino acids 194-390 of human CD45 (NP_002829.3).
Sequence：SDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFG
Gene ID：5788
Swiss prot：P08575
Synonyms：LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180; IMD105
Calculated MW：147kDa
Observed MW：Refer to figures
Images of CD45 Rabbit mAb (A23503)
Western blot analysis of various lysates, using CD45 Rabbit mAb (A23503) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):MCF7
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CD45 Rabbit mAb (A23503) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using CD45 Rabbit mAb (A23503) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using CD45 Rabbit mAb (A23503) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Please remember our product information: CD45 Rabbit mAb (Catalog Number: A23503) Abclonal
