Bcl-2 Rabbit mAb (A19693)
$148.00 – $548.00
Abclonal Bcl-2 Rabbit mAb (Catalog Number: A19693) encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes.
- Details & Specifications
- References
- More Offers
| Catalog No. | A19693 |
|---|---|
| Product Name | Bcl-2 Rabbit mAb (A19693) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | Bcl-2; PPP1R50 |
| Gene Name | BCL2 |
| Protein Name | BCL2 |
| Uniprot/Swissprot ID | P10415 |
| Gene ID | 596 |
| Clone | ARC0173 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A19693: Bcl-2 Rabbit mAb
This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.
Immunogen Information about Bcl-2 Rabbit mAb (A19693)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 1-211 of human Bcl-2 (P10415).
Sequence：MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Gene ID：596
Swiss prot：P10415
Synonyms：Bcl-2; PPP1R50
Calculated MW：26kDa
Observed MW：26kDa
Images of Bcl-2 Rabbit mAb (A19693)
Western blot analysis of various lysates using Bcl-2 Rabbit mAb (A19693) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of Bcl-2 in paraffin-embedded human tonsil using Bcl-2 Rabbit mAb (A19693) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of Bcl-2 in paraffin-embedded human follicular lymphoma using Bcl-2 Rabbit mAb (A19693) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of Bcl-2 in paraffin-embedded human appendix using Bcl-2 Rabbit mAb (A19693) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 200 μg extracts of Mouse lung using 3 μg Bcl-2 antibody (A19693). Western blot was performed from the immunoprecipitate using Bcl-2 antibody (A19693) at a dilution of 1:1000.
please remember our product information: Bcl-2 Rabbit mAb (Catalog Number: A19693) Abclonal
