ABflo® 647 Rabbit anti-Mouse CD59a mAb (A23362)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Mouse CD59a mAb (Catalog Number: A23362) Predicted to enable complement binding activity.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A23362 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Mouse CD59a mAb (A23362) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | Cd59; MACIF; MAC-IP |
| Gene Name | Cd59a |
| Protein Name | Cd59a |
| Uniprot/Swissprot ID | O55186 |
| Entrez GeneID | 12509 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Mouse |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23362: ABflo® 647 Rabbit anti-Mouse CD59a mAb
Predicted to enable complement binding activity. Involved in several processes, including negative regulation of angiogenesis; negative regulation of fibroblast growth factor production; and negative regulation of vascular endothelial growth factor receptor signaling pathway. Acts upstream of or within negative regulation of activation of membrane attack complex. Located in external side of plasma membrane. Is expressed in several structures, including Meckel’s cartilage; nervous system; neural retina; skeleton; and testis. Human ortholog(s) of this gene implicated in colorectal carcinoma and ovarian cancer. Orthologous to human CD59 (CD59 molecule (CD59 blood group)).
Immunogen Information about ABflo® 647 Rabbit anti-Mouse CD59a mAb (A23362)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 24-96 of mouse CD59a (NP_031678.1).
Sequence：LTCYHCFQPVVSSCNMNSTCSPDQDSCLYAVAGMQVYQRCWKQSDCHGEIIMDQLEETKLKFRCCQFNLCNKS
Gene ID：12509
Swiss prot：O55186
Synonyms：Cd59; MACIF; MAC-IP
Calculated MW：14kDa
Observed MW：
Images of ABflo® 647 Rabbit anti-Mouse CD59a mAb (A23362)
Flow cytometry:1X10^6 293F cells(negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Mouse CD59a mAb(A23362, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD59a mAb(A23362, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Mouse CD59a mAb (Catalog Number: A23362) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |