ABflo® 647 Rabbit anti-Mouse CD34 mAb (A23108)
$140.00 – $388.00
Abclonal ABflo® 647 Rabbit anti-Mouse CD34 mAb (Catalog Number: A23108) Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A23108 |
---|---|
Product Name | ABflo® 647 Rabbit anti-Mouse CD34 mAb (A23108) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | CD34;CD34 molecule;GIG3;MORT1 |
Gene Name | Cd34 |
Protein Name | Cd34 |
Uniprot/Swissprot ID | Q64314 |
Entrez GeneID | 12490 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | FC |
Reactivity | Mouse |
Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23108: ABflo® 647 Rabbit anti-Mouse CD34 mAb
Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region. Is expressed in several structures, including alimentary system; cardiovascular system; extraembryonic component; genitourinary system; and skin. Orthologous to human CD34 (CD34 molecule).
Immunogen Information about ABflo® 647 Rabbit anti-Mouse CD34 mAb (A23108)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 35-287 of mouse CD34 (NP_598415.1)
Sequence: TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKT
Gene ID:12490
Swiss prot:Q64314
Synonyms:CD34; CD34 molecule; GIG3; MORT1
Calculated MW:41kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Mouse CD34 mAb (A23108)
Flow cytometry:1X10^6 Neuro-2a cells (negative control, Left) and NIH/3T3 cells (Right) were surface-stained with ABflo® 647 Rabbit anti-Mouse CD34 mAb(A23108, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry:1X10^6 NIH/3T3 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD34 mAb(A23108, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Mouse CD34 mAb (Catalog Number: A23108) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |