ABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human TROP-2 mAb (Catalog Number: A22578) This intronless gene encodes a carcinoma-associated antigen.
- Details & Specifications
- References
- More Offers
Catalog No. | A22578 |
---|---|
Product Name | ABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1 |
Gene Name | TACSTD2 |
Protein Name | TACSTD2 |
Uniprot/Swissprot ID | P09758 |
Gene ID | 4070 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Reactivity | Human |
Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22578: ABflo® 647 Rabbit anti-Human TROP-2 mAb
This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.
Immunogen Information about ABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human (NP_002344.2).
Sequence:HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Gene ID:4070
Swiss prot:P09758
Synonyms:EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Calculated MW:35kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578)
Flow cytometry:1X10^6 U-118MG cells (negative control, left) and MCF7 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human TROP-2 mAb(A22578, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: ABflo® 647 Rabbit anti-Human TROP-2 mAb (Catalog Number: A22578) Abclonal