ABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578)

ABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578)

ABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 647 Rabbit anti-Human TROP-2 mAb (Catalog Number: A22578) This intronless gene encodes a carcinoma-associated antigen.

Store
SKU: A22578 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22578
Product NameABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Gene Name TACSTD2
Protein Name TACSTD2
Uniprot/Swissprot ID P09758
Gene ID 4070
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22578: ABflo® 647 Rabbit anti-Human TROP-2 mAb

This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.

Immunogen Information about ABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-274 of human (NP_002344.2).
Sequence:HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Gene ID:4070
Swiss prot:P09758
Synonyms:EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
Calculated MW:35kDa
Observed MW:

Images of ABflo® 647 Rabbit anti-Human TROP-2 mAb (A22578)

Flow cytometry:1X10^6 U-118MG cells (negative control, left) and MCF7 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human TROP-2 mAb(A22578, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Please remember our product information: ABflo® 647 Rabbit anti-Human TROP-2 mAb (Catalog Number: A22578) Abclonal