ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

$140.00$388.00

In stock

$140.00$388.00

Abclonal ABflo® 647 Rabbit anti-Human Galectin 3 mAb (Catalog Number: A23017) encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides.

Store
SKU: A23017
Clear
View cart
Catalog No. A23017
Product NameABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
Gene Name LGALS3
Protein Name LGALS3
Uniprot/Swissprot ID P17931
Entrez GeneID 3958
Clonality Monoclonal
Source/Host Rabbit
Applications FC(Intra)
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23017: ABflo® 647 Rabbit anti-Human Galectin 3 mAb

This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.

Immunogen Information about ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Immunogen:Recombinant protein of human Galectin 3.
Sequence:MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Gene ID:3958
Swiss prot:P17931
Synonyms:L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
Calculated MW:26kDa
Observed MW:

Images of ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Flow cytometry:1X10^6 Jurkat cells(Low Expression control, Left) and MCF7 cells (Right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 MCF7 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, right).

Please remember our product information: ABflo® 647 Rabbit anti-Human Galectin 3 mAb (Catalog Number: A23017) Abclonal

Additional information

Ship from Country

USA

Size

100 μg, 25 μg, 50 μg

No more offers for this product!