ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (Catalog Number: A22066) encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22066 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | K19; CK19; K1CS |
| Gene Name | KRT19 |
| Protein Name | KRT19 |
| Uniprot/Swissprot ID | P08727 |
| Entrez GeneID | 3880 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC(Intra) |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22066: ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.
Immunogen Information about ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066)
Immunogen：A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (NP_002267.2).
Sequence：RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Gene ID：3880
Swiss prot：P08727
Synonyms：K19; CK19; K1CS
Calculated MW：44kDa
Observed MW：Refer to figures
Images of ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A22066)
Flow cytometry:1X10^6 Jurkat cells (negative control, left) and MCF7 cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb(A22066, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: ABflo® 647 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (Catalog Number: A22066) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |