ABflo® 647 Rabbit anti-Human CEACAM6 mAb (A22188)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Human CEACAM6 mAb (Catalog Number: A22188) encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22188 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CEACAM6 mAb (A22188) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | NCA; CEAL; CD66c |
| Gene Name | CEACAM6 |
| Protein Name | CEACAM6 |
| Uniprot/Swissprot ID | P40199 |
| Gene ID | 4680 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22188: ABflo® 647 Rabbit anti-Human CEACAM6 mAb
This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tumor markers in serum immunoassay determinations of carcinoma. This gene affects the sensitivity of tumor cells to adenovirus infection. The protein encoded by this gene acts as a receptor for adherent-invasive E. coli adhesion to the surface of ileal epithelial cells in patients with Crohn’s disease. This gene is clustered with genes and pseudogenes of the cell adhesion molecules subgroup of the CEA family on chromosome 19.
Immunogen Information about ABflo® 647 Rabbit anti-Human CEACAM6 mAb (A22188)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 35-320 of human CEACAM6 (NP_002474.4).
Sequence:KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Gene ID:4680
Swiss prot:P40199
Synonyms:NCA; CEAL; CD66c
Calculated MW:37kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CEACAM6 mAb (A22188)

Flow cytometry:1X10^6 LNCaP cells (negative control, left) and BxPC-3 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CEACAM6 mAb(A22188, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Please remember our product information: ABflo® 647 Rabbit anti-Human CEACAM6 mAb (Catalog Number: A22188) Abclonal
