ABflo® 647 Rabbit anti-Human CD70 mAb (A22303)

ABflo® 647 Rabbit anti-Human CD70 mAb (A22303)

ABflo® 647 Rabbit anti-Human CD70 mAb (A22303)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 647 Rabbit anti-Human CD70 mAb (Catalog Number: A22303) encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27.

Store
SKU: A22303 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22303
Product NameABflo® 647 Rabbit anti-Human CD70 mAb (A22303)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A
Gene Name CD70
Protein Name CD70
Uniprot/Swissprot ID P32970
Gene ID 970
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 647. Ex:656nm. Em:670nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22303: ABflo® 647 Rabbit anti-Human CD70 mAb

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.

Immunogen Information about ABflo® 647 Rabbit anti-Human CD70 mAb (A22303)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 39-193 of human CD70 (P32970).
Sequence:QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Gene ID:970
Swiss prot:P32970
Synonyms:CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A
Calculated MW:21kDa/23kDa
Observed MW:Refer to figures

Images of ABflo® 647 Rabbit anti-Human CD70 mAb (A22303)

Flow cytometry: 1X10^6 293F cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD70 mAb (A22303, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 Raji cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD70 mAb (A22303, 5 μl/Test, right).

Please remember our product information: ABflo® 647 Rabbit anti-Human CD70 mAb (Catalog Number: A22303) Abclonal

No more offers for this product!