ABflo® 647 Rabbit anti-Human CD7 mAb (A22194)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human CD7 mAb (Catalog Number: A22194) encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A22194 |
---|---|
Product Name | ABflo® 647 Rabbit anti-Human CD7 mAb (A22194) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | GP40; TP41; Tp40; LEU-9 |
Gene Name | CD7 |
Protein Name | CD7 |
Uniprot/Swissprot ID | P09564 |
Entrez GeneID | 924 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | FC |
Reactivity | Human |
Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22194: ABflo® 647 Rabbit anti-Human CD7 mAb
This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD7 mAb (A22194)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 26-180 of human CD7 (NP_006128.1).
Sequence:AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Gene ID:924
Swiss prot:P09564
Synonyms:GP40; TP41; Tp40; LEU-9
Calculated MW:25kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CD7 mAb (A22194)
Flow cytometry:1X10^6 A549 cells (negative control, left) and MOLT-4 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD7 mAb(A22194, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD7 mAb(A22194, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD7 mAb(A22194, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD7 mAb (Catalog Number: A22194) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |