ABflo® 647 Rabbit anti-Human CD5 mAb (A22186)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Human CD5 mAb (Catalog Number: A22186) encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system.
- Details & Specifications
- References
| Catalog No. | A22186 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD5 mAb (A22186) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | T1; LEU1 |
| Gene Name | CD5 |
| Protein Name | CD5 |
| Uniprot/Swissprot ID | P06127 |
| Gene ID | 921 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22186: ABflo® 647 Rabbit anti-Human CD5 mAb
This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD5 mAb (A22186)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 25-371 of human CD5 (NP_055022.2).
Sequence:RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPN
Gene ID:921
Swiss prot:P06127
Synonyms:T1; LEU1
Calculated MW:55kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CD5 mAb (A22186)

Flow cytometry:1X10^6 K562 cells (negative control, left) and MOLT-4 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD5 mAb(A22186, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD5 mAb(A22186, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD5 mAb(A22186, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD5 mAb (Catalog Number: A22186) Abclonal





