ABflo® 647 Rabbit anti-Human CD33 mAb (A22640)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Human CD33 mAb (Catalog Number: A22640) CD33, a type I transmembrane protein, is a sialic acid-binding Ig-like lectin (Siglec-3) of the Ig superfamily, and human CD33 binds preferentially to alpha-2, 6-linked sialic acid.
- Details & Specifications
- References
- More Offers
Catalog No. | A22640 |
---|---|
Product Name | ABflo® 647 Rabbit anti-Human CD33 mAb (A22640) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | p67; SIGLEC3; SIGLEC-3 |
Gene Name | CD33 |
Protein Name | CD33 |
Uniprot/Swissprot ID | P20138 |
Gene ID | 945 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Reactivity | Human |
Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22640: ABflo® 647 Rabbit anti-Human CD33 mAb
CD33, a type I transmembrane protein, is a sialic acid-binding Ig-like lectin (Siglec-3) of the Ig superfamily, and human CD33 binds preferentially to alpha-2, 6-linked sialic acid. Upon binding to its ligands CD33 transduces an inhibitory signaling through the immunoreceptor tyrosine-based inhibitory motif (ITIM) in its intracellular domain, inhibiting cellular function such as phagocytosis. In addition, CD33 is also involved in other processes, such as adhesion. Due to its exclusive expression on hematopoietic cells, particularly the myeloid lineage and their progenitors, CD33 has been actively pursued as a therapeutic target against acute myeloid leukemia (AML) . CD33 may also be involved in Alzheimer’s Disease .
Immunogen Information about ABflo® 647 Rabbit anti-Human CD33 mAb (A22640)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 18-259 of human CD33(NP_001763.3)
Sequence:DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Gene ID:945
Swiss prot:P20138
Synonyms:p67; SIGLEC3; SIGLEC-3
Calculated MW:40kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CD33 mAb (A22640)
Flow cytometry:1X10^6 MCF7 cells (negative control, Left) and THP-1 cells (Right) were surface-stained with ABflo® 647 Rabbit anti-Human CD33 mAb(A22640, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 THP-1 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD33 mAb(A22640, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD33 mAb(A22640, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD33 mAb(A22640, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD33 mAb (Catalog Number: A22640) Abclonal