ABflo® 647 Rabbit anti-Human CD317/BST2 mAb (A22518)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Human CD317/BST2 mAb (Catalog Number: A22518) Bone marrow stromal cells are involved in the growth and development of B-cells.
- Details & Specifications
- References
- More Offers
Catalog No. | A22518 |
---|---|
Product Name | ABflo® 647 Rabbit anti-Human CD317/BST2 mAb (A22518) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | CD317; HM1.24; TETHERIN |
Gene Name | BST2 |
Protein Name | BST2 |
Uniprot/Swissprot ID | Q10589 |
Gene ID | 684 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Reactivity | Human |
Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22518: ABflo® 647 Rabbit anti-Human CD317/BST2 mAb
Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD317/BST2 mAb (A22518)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 49-160 of human CD317/BST2 (NP_004326.1).
Sequence:NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDS
Gene ID:684
Swiss prot:Q10589
Synonyms:CD317; HM1.24; TETHERIN
Calculated MW:20kDa
Observed MW:
Images of ABflo® 647 Rabbit anti-Human CD317/BST2 mAb (A22518)
Flow cytometry:1X10^6 A549 cells (negative control, left) and HeLa cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD317/BST2 mAb(A22518, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Hela cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human BST2 mAb(A22518, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD317/BST2 mAb (Catalog Number: A22518) Abclonal