ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb (A23015)
$140.00 – $388.00
Abclonal ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb (Catalog Number: A23015) Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A23015 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb (A23015) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | MN; GPA; MNS; GPSAT; PAS-2; CD235a; GPErik; HGpMiV; HGpMiXI; HGpSta(C) |
| Gene Name | GYPA |
| Protein Name | GYPA |
| Uniprot/Swissprot ID | P02724 |
| Entrez GeneID | 2993 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Human |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23015: ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb
Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB.
Immunogen Information about ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb (A23015)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 20-91 of human CD235a (NP_002090.4).
Sequence：SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Gene ID：2993
Swiss prot：P02724
Synonyms：MN; GPA; MNS; GPSAT; PAS-2; CD235a; GPErik; HGpMiV; HGpMiXI; HGpSta(C)
Calculated MW：13kDa/16kDa
Observed MW：Refer to figures
Images of ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb (A23015)
Flow cytometry:1X10^6 THP1 cells (negative control, Left) and HEL cells (Right) were surface-stained with ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb(A23015, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry: 1X10^6 THP1 cells(negative control) were surface-stained with ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb(A23015, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained THP1 cells was used as blank control (red line).
Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb(A23015, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Human CD235a/Glycophorin A mAb (Catalog Number: A23015) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |