ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)
$218.00 – $568.00
Abclonal ABflo® 647 Rabbit anti-Dog CD4 mAb (Catalog Number: A22688) Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22688 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis |
| Gene Name | CD4 |
| Protein Name | CD4 |
| Entrez GeneID | 403931 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Dog |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22688: ABflo® 647 Rabbit anti-Dog CD4 mAb
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages.
Immunogen Information about ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 26-400 of dog CD4 (NP_001003252.1).
Sequence：REVVLGKAGDAVELPCQTSQKKNIHFNWRDSSMVQILGNQGSFWTVGSSRLKHRVESKKNLWDQGSFPLVIKDLEVADSGIYFCDTDKRQEVELLVFNLTAKWDSGSSSGSSNIRLLQGQQLTLTLENPSGSSPSVQWKGPGNKSKHGGQNLSLSWPELQDGGTWTCIISQSQKTVEFNINVLVLAFQKVSNTFYAREGDQVEFSFPLSFEDENLVGELRWQAQGASSSLLWISFTLENRKLSMKEAHAPLKLQMKESLPLRFTLPQVLSRYAGSGILTLNLAKGTLYQEVNLVVMRANSSQNNLTCEVLGPTSPELTLSLNLKEQAAKVSKQQKLVWVVDPEGGTWQCLLSDKDKVLLASSLNVSSPVVIKSWP
Gene ID：403931
Swiss prot：
Synonyms：Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis
Calculated MW：
Observed MW：
Images of ABflo® 647 Rabbit anti-Dog CD4 mAb (A22688)
Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Dog CD4 mAb(A22688, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Dog CD4 mAb(A22688, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Dog CD4 mAb (Catalog Number: A22688) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |