ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Cat CD3G mAb (Catalog Number: A22491) encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A22491 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | T3G; IMD17; CD3GAMMA; CD3-GAMMA |
| Gene Name | CD3G |
| Protein Name | CD3G |
| Entrez GeneID | 101089292 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Cat |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22491: ABflo® 647 Rabbit anti-Cat CD3G mAb
The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.
Immunogen Information about ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of cat CD3G (XP_003992456.3).
Sequence：QSKQEIPVVRVNSDREDGSVLLTCESPDKDVKWFQDGKEMTPHKKNKNIQNLGSSIKDPRGIYWCQGSKNRSRTLQVYFRMCQNCIELSRATVS
Gene ID：101089292
Swiss prot：
Synonyms：T3G; IMD17; CD3GAMMA; CD3-GAMMA
Calculated MW：20kDa
Observed MW：
Images of ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491)
Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Cat CD3G mAb (A22491, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Cat CD3G mAb (Catalog Number: A22491) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |