ABflo® 647 Rabbit anti-Cat CD27 mAb (A23172)
$290.00 – $768.00
Abclonal ABflo® 647 Rabbit anti-Cat CD27 mAb (Catalog Number: A23172) encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity.
- Product Details
- Description
- Additional information
- More Offers
| Catalog No. | A23172 |
|---|---|
| Product Name | ABflo® 647 Rabbit anti-Cat CD27 mAb (A23172) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Gene Name | CD27 |
| Protein Name | CD27 |
| Entrez GeneID | 101091633 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Applications | FC |
| Reactivity | Cat |
| Conjugate | ABflo® 647. Ex:656nm. Em:670nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23172: ABflo® 647 Rabbit anti-Cat CD27 mAb
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
Immunogen Information about ABflo® 647 Rabbit anti-Cat CD27 mAb (A23172)
Immunogen：Recombinant protein of cat CD27.
Sequence：ATLAPQCCPEKHYWAQGQLCCQMCKPGTFLVKDCDRHGEAAQCDPCIPGASFSPDHHIRRHCESCRHCNSGLLIRNCTLTANAECACPKGWQCRDKECTECDPPSNPSLTPRPPQAPGPHPQPTHLPYAKKMPEAGTVRQVQTLADFRWLPAPALSTHGPPQRSLCSTDCIR
Gene ID：101091633
Swiss prot：
Synonyms：
Calculated MW：
Observed MW：
Images of ABflo® 647 Rabbit anti-Cat CD27 mAb (A23172)
Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Cat CD27 mAb(A23172, 5 μl/Test, orange line) or ABflo®647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 293F cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Cat CD27 mAb(A23172, 5 μl/Test, right).
Please remember our product information: ABflo® 647 Rabbit anti-Cat CD27 mAb (Catalog Number: A23172) Abclonal
Additional information
| Ship from Country | USA |
|---|---|
| Size | 100 μg, 25 μg, 50 μg |