ABflo® 594 Rabbit anti-Human CD59 mAb (A23365)

ABflo® 594 Rabbit anti-Human CD59 mAb (A23365)

ABflo® 594 Rabbit anti-Human CD59 mAb (A23365)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 594 Rabbit anti-Human CD59 mAb (Catalog Number: A23365) encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction.

Store
SKU: A23365 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A23365
Product NameABflo® 594 Rabbit anti-Human CD59 mAb (A23365)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20
Gene Name CD59
Protein Name CD59
Uniprot/Swissprot ID P13987
Gene ID 966
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 594. Ex:594nm. Em:619nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A23365: ABflo® 594 Rabbit anti-Human CD59 mAb

This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.

Immunogen Information about ABflo® 594 Rabbit anti-Human CD59 mAb (A23365)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 26-101 of human CD59 (NP_000602.1).
Sequence:LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLE
Gene ID:966
Swiss prot:P13987
Synonyms:1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20
Calculated MW:14kDa
Observed MW:

Images of ABflo® 594 Rabbit anti-Human CD59 mAb (A23365)

Flow cytometry:1X10^6 U937 cells(negative control, left) and Jurkat cells were surface-stained with ABflo® 488 Rabbit Rabbit anti-Human CD59 mAb(A23365, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 Jurkat cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD59 mAb(A23365, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD59 mAb(A23365, 5 μl/Test, right).

Please remember our product information: ABflo® 594 Rabbit anti-Human CD59 mAb (Catalog Number: A23365) Abclonal

No more offers for this product!