ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (A22152)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (Catalog Number: A22152) encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A22152 |
---|---|
Product Name | ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (A22152) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16 |
Gene Name | MS4A1 |
Protein Name | MS4A1 |
Uniprot/Swissprot ID | P11836 |
Entrez GeneID | 931 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | FC |
Reactivity | Human, Monkey |
Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22152: ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb
This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
Immunogen Information about ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (A22152)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 mAb (NP_068769.2).
Sequence:LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Gene ID:931
Swiss prot:P11836
Synonyms:B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16
Calculated MW:14kDa/33kDa
Observed MW:Refer to figures
Images of ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (A22152)
Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).
Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, right).
Flow cytometry:1X10^6 Monkey PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test).The cells were simultaneously stained with ABflo® 647 Rabbit anti-Human CD27 mAb(A22064,5 μl/Test).
Flow cytometry:1X10^6 Monkey PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test).The cells were simultaneously stained with ABflo® 647 Rabbit anti-Human CD27 mAb(A22064,5 μl/Test).
Please remember our product information: ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (Catalog Number: A22152) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |