ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (A22152)

Catalog No.	A22152
Product Name	ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (A22152)
Supplier Name	ABclonal, Inc.
Brand Name	Abclonal
Synonyms	B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16
Gene Name	MS4A1
Protein Name	MS4A1
Uniprot/Swissprot ID	P11836
Entrez GeneID	931
Clonality	Monoclonal
Source/Host	Rabbit
Applications	FC
Reactivity	Human, Monkey
Conjugate	ABflo® 488. Ex:491nm. Em:516nm.
Note	Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline	Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22152: ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.

Immunogen Information about ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (A22152)

Immunogen：A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 mAb (NP_068769.2).
Sequence：LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Gene ID：931
Swiss prot：P11836
Synonyms：B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16
Calculated MW：14kDa/33kDa
Observed MW：Refer to figures

Images of ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (A22152)

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, right).

Flow cytometry:1X10^6 Monkey PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test).The cells were simultaneously stained with ABflo® 647 Rabbit anti-Human CD27 mAb(A22064，5 μl/Test).

Flow cytometry:1X10^6 Monkey PBMC cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test) or ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb(A22152, 5 μl/Test).The cells were simultaneously stained with ABflo® 647 Rabbit anti-Human CD27 mAb(A22064，5 μl/Test).

Please remember our product information: ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb (Catalog Number: A22152) Abclonal

Additional information

Ship from Country	USA
Size	100 μg, 25 μg, 50 μg

No more offers for this product!