ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb (A22631)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb (Catalog Number: A22631) Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A22631 |
---|---|
Product Name | ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb (A22631) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2 |
Gene Name | GPC3 |
Protein Name | GPC3 |
Uniprot/Swissprot ID | P51654 |
Entrez GeneID | 2719 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | FC |
Reactivity | Human |
Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22631: ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants.
Immunogen Information about ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb (A22631)
Immunogen:A synthetic peptide corresponding to a sequence within amino acids 481-580 of human Glypican 3 (GPC3) (NP_004475.1).
Sequence:GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH
Gene ID:2719
Swiss prot:P51654
Synonyms:SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2
Calculated MW:59kDa/65kDa/68kDa
Observed MW:Refer to figures
Images of ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb (A22631)
Flow cytometry:1X10^6 K-562 cells (negative control, Left) and HepG2 cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb(A22631, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 HepG2 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb(A22631, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb (Catalog Number: A22631) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |