ABflo® 488 Rabbit anti-Human CD79a mAb (A22300)

ABflo® 488 Rabbit anti-Human CD79a mAb (A22300)

ABflo® 488 Rabbit anti-Human CD79a mAb (A22300)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Human CD79a mAb (Catalog Number: A22300) The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig).

Store
SKU: A22300 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22300
Product NameABflo® 488 Rabbit anti-Human CD79a mAb (A22300)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms IGA; MB1; MB-1; IGAlpha
Gene Name CD79A
Protein Name CD79A
Uniprot/Swissprot ID P11912
Gene ID 973
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22300: ABflo® 488 Rabbit anti-Human CD79a mAb

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD79a mAb (A22300)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).
Sequence:FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
Gene ID:973
Swiss prot:P11912
Synonyms:IGA; MB1; MB-1; IGAlpha
Calculated MW:25kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Human CD79a mAb (A22300)

Flow cytometry: 1X10^6 Daudi cells were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Daudi cells was used as blank control (red line).

Flow cytometry: 1X10^6 C2C12 cells(negative control) were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained C2C12 cells was used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD79a mAb (Catalog Number: A22300) Abclonal