ABflo® 488 Rabbit anti-Human CD68 mAb (A22514)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD68 mAb (Catalog Number: A22514) encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family.
- Details & Specifications
- References
| Catalog No. | A22514 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD68 mAb (A22514) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | GP110; LAMP4; SCARD1 |
| Gene Name | CD68 |
| Protein Name | CD68 |
| Uniprot/Swissprot ID | P34810 |
| Gene ID | 968 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22514: ABflo® 488 Rabbit anti-Human CD68 mAb
This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD68 mAb (A22514)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 22-319 of human CD68 (NP_001242.2).
Sequence:NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS
Gene ID:968
Swiss prot:P34810
Synonyms:GP110; LAMP4; SCARD1
Calculated MW:37kDa
Observed MW:Refer to figures
Images of ABflo® 488 Rabbit anti-Human CD68 mAb (A22514)

Flow cytometry:1X10^6 MOLT-4 cells (Low Expression, left) and A-431 cells (right) were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD68 mAb(A22514, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 A431 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD68 mAb(A22514, 5 μl/Test, right).

Flow cytometry:1X10^6 MOLT-4 cells(Low Expression) were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD68 mAb(A22514, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD68 mAb(A22514, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD68 mAb(A22514, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD68 mAb (Catalog Number: A22514) Abclonal







