ABflo® 488 Rabbit anti-Human CD62L/L-Selectin mAb (A23020)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Human CD62L/L-Selectin mAb (Catalog Number: A23020) encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors.
- Details & Specifications
- References
| Catalog No. | A23020 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD62L/L-Selectin mAb (A23020) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | TQ1; LAM1; LEU8; LNHR; LSEL; CD62L; LYAM1; PLNHR; LECAM1 |
| Gene Name | SELL |
| Protein Name | SELL |
| Uniprot/Swissprot ID | P14151 |
| Gene ID | 6402 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A23020: ABflo® 488 Rabbit anti-Human CD62L/L-Selectin mAb
This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD62L/L-Selectin mAb (A23020)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 39-332 of human CD62L/L-Selectin (NP_000646.3).
Sequence:WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
Gene ID:6402
Swiss prot:P14151
Synonyms:TQ1; LAM1; LEU8; LNHR; LSEL; CD62L; LYAM1; PLNHR; LECAM1
Calculated MW:42kDa/43kDa
Observed MW:Refer to figures
Images of ABflo® 488 Rabbit anti-Human CD62L/L-Selectin mAb (A23020)

Flow cytometry:1X10^6 T-47D cells (negative control, Left) and MOLT-4 cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human CD62L/L-Selectin mAb(A23020, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 MOLT-4 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD62L/L-Selectin mAb(A23020, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD62L/L-Selectin mAb (Catalog Number: A23020) Abclonal



