ABflo® 488 Rabbit anti-Human CD58 mAb (A22512)
$290.00 – $768.00
Abclonal ABflo® 488 Rabbit anti-Human CD58 mAb (Catalog Number: A22512) encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes.
- Details & Specifications
- References
- More Offers
| Catalog No. | A22512 |
|---|---|
| Product Name | ABflo® 488 Rabbit anti-Human CD58 mAb (A22512) |
| Supplier Name | ABclonal, Inc. |
| Brand Name | Abclonal |
| Synonyms | ag3; LFA3; LFA-3 |
| Gene Name | CD58 |
| Protein Name | CD58 |
| Uniprot/Swissprot ID | P19256 |
| Gene ID | 965 |
| Clonality | Monoclonal |
| Source/Host | Rabbit |
| Reactivity | Human |
| Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
| Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
| Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22512: ABflo® 488 Rabbit anti-Human CD58 mAb
This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD58 mAb (A22512)
Immunogen：Recombinant fusion protein containing a sequence corresponding to amino acids 29-215 of human CD58 (NP_001770.1).
Sequence：FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Gene ID：965
Swiss prot：P19256
Synonyms：ag3; LFA3; LFA-3
Calculated MW：28kDa
Observed MW：Refer to figures
Images of ABflo® 488 Rabbit anti-Human CD58 mAb (A22512)
Flow cytometry:1X10^6 A204 cells (Low Expression, left) and MCF7 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD58 mAb(A22512, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 MCF7 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD58 mAb(A22512, 5 μl/Test, right).
Flow cytometry:1X10^6 A204 cells(Low Expression) were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD58 mAb(A22512, 5 μl/Test, right).
Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human CD58 mAb(A22512, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD58 mAb (Catalog Number: A22512) Abclonal
