ABflo® 488 Rabbit anti-Human CD40 mAb (A22641)

ABflo® 488 Rabbit anti-Human CD40 mAb (A22641)

ABflo® 488 Rabbit anti-Human CD40 mAb (A22641)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Human CD40 mAb (Catalog Number: A22641) This gene is a member of the TNF-receptor superfamily.

Store
SKU: A22641 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22641
Product NameABflo® 488 Rabbit anti-Human CD40 mAb (A22641)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms p50; Bp50; CDW40; TNFRSF5
Gene Name CD40
Protein Name CD40
Uniprot/Swissprot ID P25942
Gene ID 958
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22641: ABflo® 488 Rabbit anti-Human CD40 mAb

This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Immunogen Information about ABflo® 488 Rabbit anti-Human CD40 mAb (A22641)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (NP_001241.1).
Sequence:EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Gene ID:958
Swiss prot:P25942
Synonyms:p50; Bp50; CDW40; TNFRSF5
Calculated MW:31kDa
Observed MW:Refer to figures

Images of ABflo® 488 Rabbit anti-Human CD40 mAb (A22641)

Flow cytometry:1X10^6 Jurkat cells (negative control, Left) and U-2OS cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human CD40 mAb(A22641, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 U-2OS cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD40 mAb(A22641, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human CD40 mAb(A22641, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD40 mAb(A22641, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Human CD40 mAb (Catalog Number: A22641) Abclonal