ABflo® 488 Rabbit anti-Human CD142 mAb (A22492)
$218.00 – $568.00
Abclonal ABflo® 488 Rabbit anti-Human CD142 mAb (Catalog Number: A22492) encodes coagulation factor III which is a cell surface glycoprotein.
- Product Details
- Description
- Additional information
- More Offers
Catalog No. | A22492 |
---|---|
Product Name | ABflo® 488 Rabbit anti-Human CD142 mAb (A22492) |
Supplier Name | ABclonal, Inc. |
Brand Name | Abclonal |
Synonyms | TF; TFA; CD142 |
Gene Name | F3 |
Protein Name | F3 |
Uniprot/Swissprot ID | P13726 |
Entrez GeneID | 2152 |
Clonality | Monoclonal |
Source/Host | Rabbit |
Applications | IF/ICC, FC |
Reactivity | Human |
Conjugate | ABflo® 488. Ex:491nm. Em:516nm. |
Note | Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com. |
Order Offline | Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com |
Description
A22492: ABflo® 488 Rabbit anti-Human CD142 mAb
This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces, for example, on monocytes. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. Platelets and monocytes have been shown to express this coagulation factor under procoagulatory and proinflammatory stimuli, and a major role in HIV-associated coagulopathy has been described. Platelet-dependent monocyte expression of coagulation factor III has been described to be associated with Coronavirus Disease 2019 (COVID-19) severity and mortality. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.
Immunogen Information about ABflo® 488 Rabbit anti-Human CD142 mAb (A22492)
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 34-251 of human CD142 (NP_001984.1).
Sequence:GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Gene ID:2152
Swiss prot:P13726
Synonyms:TF; TFA; CD142
Calculated MW:33kDa
Observed MW:
Images of ABflo® 488 Rabbit anti-Human CD142 mAb (A22492)
Immunofluorescence analysis of A-431 using ABflo® 488 Rabbit anti-Human CD142 mAb (A22492) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Flow cytometry: 1X10^6 HEL cells (negative control, left) and A-431 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD142 mAb (A22492, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry: 1X10^6 A-431 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD142 mAb (A22492, 5 μl/Test, right).
Please remember our product information: ABflo® 488 Rabbit anti-Human CD142 mAb (Catalog Number: A22492) Abclonal
Additional information
Ship from Country | USA |
---|---|
Size | 100 μg, 25 μg, 50 μg |