ABflo® 488 Rabbit anti-Dog CD4 mAb (A22687)

ABflo® 488 Rabbit anti-Dog CD4 mAb (A22687)

ABflo® 488 Rabbit anti-Dog CD4 mAb (A22687)

$218.00$568.00

In stock

$218.00$568.00

Abclonal ABflo® 488 Rabbit anti-Dog CD4 mAb (Catalog Number: A22687) Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses.

Store
SKU: A22687 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22687
Product NameABflo® 488 Rabbit anti-Dog CD4 mAb (A22687)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis
Gene Name CD4
Protein Name CD4
Gene ID 403931
Clonality Monoclonal
Source/Host Rabbit
Reactivity Dog
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22687: ABflo® 488 Rabbit anti-Dog CD4 mAb

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages.

Immunogen Information about ABflo® 488 Rabbit anti-Dog CD4 mAb (A22687)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 26-400 of dog CD4 (NP_001003252.1).
Sequence:REVVLGKAGDAVELPCQTSQKKNIHFNWRDSSMVQILGNQGSFWTVGSSRLKHRVESKKNLWDQGSFPLVIKDLEVADSGIYFCDTDKRQEVELLVFNLTAKWDSGSSSGSSNIRLLQGQQLTLTLENPSGSSPSVQWKGPGNKSKHGGQNLSLSWPELQDGGTWTCIISQSQKTVEFNINVLVLAFQKVSNTFYAREGDQVEFSFPLSFEDENLVGELRWQAQGASSSLLWISFTLENRKLSMKEAHAPLKLQMKESLPLRFTLPQVLSRYAGSGILTLNLAKGTLYQEVNLVVMRANSSQNNLTCEVLGPTSPELTLSLNLKEQAAKVSKQQKLVWVVDPEGGTWQCLLSDKDKVLLASSLNVSSPVVIKSWP
Gene ID:403931
Swiss prot:
Synonyms:Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis
Calculated MW:
Observed MW:

Images of ABflo® 488 Rabbit anti-Dog CD4 mAb (A22687)

Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Dog CD4 mAb(A22687, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Dog CD4 mAb(A22687, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Dog CD4 mAb (Catalog Number: A22687) Abclonal