ABflo® 488 Rabbit anti-Dog CD27 mAb (A22575)

ABflo® 488 Rabbit anti-Dog CD27 mAb (A22575)

ABflo® 488 Rabbit anti-Dog CD27 mAb (A22575)

$290.00$768.00

In stock

$290.00$768.00

Abclonal ABflo® 488 Rabbit anti-Dog CD27 mAb (Catalog Number: A22575) encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity.

Store
SKU: A22575 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A22575
Product NameABflo® 488 Rabbit anti-Dog CD27 mAb (A22575)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms T14; S152; Tp55; TNFRSF7; S152. LPFS2
Gene Name CD27
Protein Name CD27
Gene ID 611674
Clonality Monoclonal
Source/Host Rabbit
Reactivity Dog
Conjugate ABflo® 488. Ex:491nm. Em:516nm.
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A22575: ABflo® 488 Rabbit anti-Dog CD27 mAb

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.

Immunogen Information about ABflo® 488 Rabbit anti-Dog CD27 mAb (A22575)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-215 of dog CD27 (XP_038295140.1).
Sequence:ATPAPKRCPEKHYQVQGERCCQMCKPGTFLVKDCERHGEAAQCDPCIPGASFSPDHHARRHCESCRHCNSGLLIRNCTLTANAECDCPKGWKCRDKQCTECDPPSNPLLIPHPSPARGPHLQPTHLPYAKIKFQATLCPVTGIVRLSPQSPPSPKMQETSTVRQVQTLADFRWLPAPALSTHWPPQRSLCSSDCIR
Gene ID:611674
Swiss prot:
Synonyms:T14; S152; Tp55; TNFRSF7; S152. LPFS2
Calculated MW:31kDa
Observed MW:

Images of ABflo® 488 Rabbit anti-Dog CD27 mAb (A22575)

Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Dog CD27 mAb(A22575, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti- Dog CD27 mAb(A22575, 5 μl/Test, right).

Please remember our product information: ABflo® 488 Rabbit anti-Dog CD27 mAb (Catalog Number: A22575) Abclonal

No more offers for this product!