S100B Rabbit mAb (A19108)

S100B Rabbit mAb (A19108)

S100B Rabbit mAb (A19108)

$148.00$548.00

In stock

$148.00$548.00

Abclonal S100B Rabbit mAb (Catalog Number: A19108) encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs.

Store
SKU: A19108 Categories: ,
Clear
View cart
Order Offline:
Phone: 1-617-401-8149
Fax: 1-617-606-5019
Email: message@sydlabs.com
Catalog No. A19108
Product NameS100B Rabbit mAb (A19108)
Supplier Name ABclonal, Inc.
Brand Name Abclonal
Synonyms NEF; S100; S100-B; S100beta
Gene Name S100B
Protein Name S100B
Uniprot/Swissprot ID P04271
Gene ID 6285
Clone ARC50351
Clonality Monoclonal
Source/Host Rabbit
Reactivity Human, Mouse, Rat
Conjugate Unconjugated
Note Products will be shipped from the warehouse in Massachusetts. Promotion is running from time to time. Welcome to send a request for quote to message@sydlabs.com.
Order Offline Syd Labs, Inc. 4 Avenue E, Hopkinton, MA 01748 USA. Phone: 1-617-401-8149 Fax: 1-617-606-5019 Email: message@sydlabs.com

Description

A19108: S100B Rabbit mAb

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer’s disease, Down’s syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes.

Immunogen Information about S100B Rabbit mAb (A19108)

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100B (NP_006263.1).
Sequence:MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Gene ID:6285
Swiss prot:P04271
Synonyms:NEF; S100; S100-B; S100beta; S100B
Calculated MW:11kDa
Observed MW:11kDa

Images of S100B Rabbit mAb (A19108)


Western blot analysis of lysates from Rat brain, using S100B Rabbit mAb (A19108) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of various lysates, using S100B Rabbit mAb (A19108) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunohistochemistry analysis of S100B in paraffin-embedded human esophagus tissue using S100B Rabbit mAb (A19108) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of S100B in paraffin-embedded human esophagus tissue using S100B Rabbit mAb (A19108) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of S100B in paraffin-embedded rat brain tissue using S100B Rabbit mAb (A19108) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of S100B in paraffin-embedded rat spleen tissue using S100B Rabbit mAb (A19108) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of S100B in paraffin-embedded human brain tissue using S100B Rabbit mAb (A19108) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of S100B in paraffin-embedded human kidney tissue using S100B Rabbit mAb (A19108) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of S100B in paraffin-embedded mouse colon tissue using S100B Rabbit mAb (A19108) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of S100B in paraffin-embedded rat colon tissue using S100B Rabbit mAb (A19108) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of S100B in paraffin-embedded mouse brain tissue using S100B Rabbit mAb (A19108) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Confocal imaging of paraffin-embedded rat brain using S100B Rabbit mAb (A19108, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded mouse brain using S100B Rabbit mAb (A19108, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Please remember our product information: S100B Rabbit mAb (Catalog Number: A19108) Abclonal